PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10001631m
Common NameEUTSA_v10001632mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24445.9 Da    PI: 9.4703
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10001631mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRrng+lKKA+ELSvLCdaev++iifs++gklye++s
  Thhalv10001631m  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS 59
                     79***********************************************86 PP

2K-box96.44.5e-3277171498
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       s+k ++e+++++l++e+a++ k+ie+L+ ++R+llGe+++s+s++eLqq+eqqLeks+k iR++K+++++eqie+l++kek+l  en++L++k
  Thhalv10001631m  77 ISSKPVSEENMQHLKHEAANMMKKIEQLEASKRKLLGEGIGSCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEKLTEK 170
                      567779**************************************************************************************99 PP

            K-box  98 l 98 
                      +
  Thhalv10001631m 171 W 171
                      7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
CDDcd002651.66E-41376No hitNo description
SuperFamilySSF554551.18E-33382IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-2984170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.80387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVSLIIFSP KGKLYEFASS  60
NMQDTIDRYL RHTKDRISSK PVSEENMQHL KHEAANMMKK IEQLEASKRK LLGEGIGSCS  120
IEELQQIEQQ LEKSVKCIRA RKTQVFKEQI EQLKQKEKAL AAENEKLTEK WGSHEIEVWS  180
NKNQESGRGD EESSPSSEVE TQLFIGLPCS TRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A6e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D6e-19369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A6e-19372271Myocyte-specific enhancer factor 2A
3kov_B6e-19372271Myocyte-specific enhancer factor 2A
3kov_I6e-19372271Myocyte-specific enhancer factor 2A
3kov_J6e-19372271Myocyte-specific enhancer factor 2A
3mu6_A6e-19369268Myocyte-specific enhancer factor 2A
3mu6_B6e-19369268Myocyte-specific enhancer factor 2A
3mu6_C6e-19369268Myocyte-specific enhancer factor 2A
3mu6_D6e-19369268Myocyte-specific enhancer factor 2A
3p57_A6e-19372271Myocyte-specific enhancer factor 2A
3p57_B6e-19372271Myocyte-specific enhancer factor 2A
3p57_C6e-19372271Myocyte-specific enhancer factor 2A
3p57_D6e-19372271Myocyte-specific enhancer factor 2A
3p57_I6e-19372271Myocyte-specific enhancer factor 2A
3p57_J6e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSAU256960.0U25696.1 Sinapis alba transcription factor SaMADS A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397744.11e-155hypothetical protein EUTSA_v10001632mg
RefseqXP_006397745.11e-155hypothetical protein EUTSA_v10001632mg
SwissprotO646451e-143SOC1_ARATH; MADS-box protein SOC1
TrEMBLV4LHF11e-155V4LHF1_EUTSA; Uncharacterized protein
STRINGBra000393.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-124AGAMOUS-like 20